TEX33 polyclonal antibody
  • TEX33 polyclonal antibody

TEX33 polyclonal antibody

Ref: AB-PAB20332
TEX33 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TEX33.
Información adicional
Size 100 uL
Gene Name TEX33
Gene Alias LL22NC01-81G9.2|C22orf33|EAN57|cE81G9.2
Gene Description testis expressed 33
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLFRGAAEETKSLMKASYTPEVIEKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TEX33.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339669
Iso type IgG

Enviar un mensaje


TEX33 polyclonal antibody

TEX33 polyclonal antibody