GLCCI1 polyclonal antibody
  • GLCCI1 polyclonal antibody

GLCCI1 polyclonal antibody

Ref: AB-PAB20331
GLCCI1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLCCI1.
Información adicional
Size 100 uL
Gene Name GLCCI1
Gene Alias FAM117C|GIG18|TSSN1
Gene Description glucocorticoid induced transcript 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLCCI1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 113263
Iso type IgG

Enviar un mensaje


GLCCI1 polyclonal antibody

GLCCI1 polyclonal antibody