LRP2 polyclonal antibody
  • LRP2 polyclonal antibody

LRP2 polyclonal antibody

Ref: AB-PAB20330
LRP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRP2.
Información adicional
Size 100 uL
Gene Name LRP2
Gene Alias DBS|gp330
Gene Description low density lipoprotein-related protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4036
Iso type IgG

Enviar un mensaje


LRP2 polyclonal antibody

LRP2 polyclonal antibody