USP40 polyclonal antibody
  • USP40 polyclonal antibody

USP40 polyclonal antibody

Ref: AB-PAB20322
USP40 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant USP40.
Información adicional
Size 100 uL
Gene Name USP40
Gene Alias FLJ10785|FLJ42100
Gene Description ubiquitin specific peptidase 40
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLCQLESEEKQVKISATVNTMVFDIRIKAIKELKLMKELADNSCLRPIDRNGKLLCPVPDSYTLKEAELKMGSSLGLCLGKAPSSSQLFLFFAMGSDVQPGTEMEIVVEETISVRDCLKLMLKKSGLQGDAWHLRKMDWCYEAGEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human USP40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55230
Iso type IgG

Enviar un mensaje


USP40 polyclonal antibody

USP40 polyclonal antibody