GRHL1 polyclonal antibody
  • GRHL1 polyclonal antibody

GRHL1 polyclonal antibody

Ref: AB-PAB20320
GRHL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GRHL1.
Información adicional
Size 100 uL
Gene Name GRHL1
Gene Alias LBP-32|LBP32|MGR|TFCP2L2
Gene Description grainyhead-like 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GRHL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29841
Iso type IgG

Enviar un mensaje


GRHL1 polyclonal antibody

GRHL1 polyclonal antibody