CNOT4 polyclonal antibody
  • CNOT4 polyclonal antibody

CNOT4 polyclonal antibody

Ref: AB-PAB20317
CNOT4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNOT4.
Información adicional
Size 100 uL
Gene Name CNOT4
Gene Alias CLONE243|NOT4|NOT4H
Gene Description CCR4-NOT transcription complex, subunit 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNOT4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4850
Iso type IgG

Enviar un mensaje


CNOT4 polyclonal antibody

CNOT4 polyclonal antibody