LDOC1L polyclonal antibody
  • LDOC1L polyclonal antibody

LDOC1L polyclonal antibody

Ref: AB-PAB20315
LDOC1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LDOC1L.
Información adicional
Size 100 uL
Gene Name LDOC1L
Gene Alias DKFZp761O17121|Mar6|Mart6|dJ1033E15.2
Gene Description leucine zipper, down-regulated in cancer 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LDOC1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84247
Iso type IgG

Enviar un mensaje


LDOC1L polyclonal antibody

LDOC1L polyclonal antibody