ITGBL1 polyclonal antibody
  • ITGBL1 polyclonal antibody

ITGBL1 polyclonal antibody

Ref: AB-PAB20310
ITGBL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ITGBL1.
Información adicional
Size 100 uL
Gene Name ITGBL1
Gene Alias OSCP|TIED
Gene Description integrin, beta-like 1 (with EGF-like repeat domains)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ITGBL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9358
Iso type IgG

Enviar un mensaje


ITGBL1 polyclonal antibody

ITGBL1 polyclonal antibody