MAFB polyclonal antibody
  • MAFB polyclonal antibody

MAFB polyclonal antibody

Ref: AB-PAB20308
MAFB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAFB.
Información adicional
Size 100 uL
Gene Name MAFB
Gene Alias KRML|MGC43127
Gene Description v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAFB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9935
Iso type IgG

Enviar un mensaje


MAFB polyclonal antibody

MAFB polyclonal antibody