CECR5 polyclonal antibody
  • CECR5 polyclonal antibody

CECR5 polyclonal antibody

Ref: AB-PAB20301
CECR5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CECR5.
Información adicional
Size 100 uL
Gene Name CECR5
Gene Alias -
Gene Description cat eye syndrome chromosome region, candidate 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQYAEDLIRRQAERRGWAAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTRQQQPSASQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CECR5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27440
Iso type IgG

Enviar un mensaje


CECR5 polyclonal antibody

CECR5 polyclonal antibody