DLGAP5 polyclonal antibody
  • DLGAP5 polyclonal antibody

DLGAP5 polyclonal antibody

Ref: AB-PAB20300
DLGAP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DLGAP5.
Información adicional
Size 100 uL
Gene Name DLGAP5
Gene Alias DLG1|DLG7|HURP|KIAA0008
Gene Description discs, large (Drosophila) homolog-associated protein 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DLGAP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9787
Iso type IgG

Enviar un mensaje


DLGAP5 polyclonal antibody

DLGAP5 polyclonal antibody