SEC31A polyclonal antibody
  • SEC31A polyclonal antibody

SEC31A polyclonal antibody

Ref: AB-PAB20295
SEC31A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC31A.
Información adicional
Size 100 uL
Gene Name SEC31A
Gene Alias ABP125|ABP130|DKFZp686N07171|HSPC275|HSPC334|KIAA0905|MGC90305|SEC31L1
Gene Description SEC31 homolog A (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC31A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22872
Iso type IgG

Enviar un mensaje


SEC31A polyclonal antibody

SEC31A polyclonal antibody