SF4 polyclonal antibody
  • SF4 polyclonal antibody

SF4 polyclonal antibody

Ref: AB-PAB20289
SF4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SF4.
Información adicional
Size 100 uL
Gene Name SF4
Gene Alias DKFZp434E2216|F23858|RBP
Gene Description splicing factor 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SF4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57794
Iso type IgG

Enviar un mensaje


SF4 polyclonal antibody

SF4 polyclonal antibody