MYEF2 polyclonal antibody
  • MYEF2 polyclonal antibody

MYEF2 polyclonal antibody

Ref: AB-PAB20288
MYEF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYEF2.
Información adicional
Size 100 uL
Gene Name MYEF2
Gene Alias FLJ11213|HsT18564|KIAA1341|MEF-2|MGC87325|MST156|MSTP156
Gene Description myelin expression factor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYEF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 50804
Iso type IgG

Enviar un mensaje


MYEF2 polyclonal antibody

MYEF2 polyclonal antibody