SCAP polyclonal antibody
  • SCAP polyclonal antibody

SCAP polyclonal antibody

Ref: AB-PAB20276
SCAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCAP.
Información adicional
Size 100 uL
Gene Name SCAP
Gene Alias KIAA0199
Gene Description SREBF chaperone
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPVYSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLED
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCAP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22937
Iso type IgG

Enviar un mensaje


SCAP polyclonal antibody

SCAP polyclonal antibody