ZNF75D polyclonal antibody
  • ZNF75D polyclonal antibody

ZNF75D polyclonal antibody

Ref: AB-PAB20274
ZNF75D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF75D.
Información adicional
Size 100 uL
Gene Name ZNF75D
Gene Alias D8C6|MGC126327|ZNF75|ZNF82
Gene Description zinc finger protein 75D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ETVISLGLKLKNDTGNDHPISVSTSEIQTSGCEVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPTGEKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF75D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7626
Iso type IgG

Enviar un mensaje


ZNF75D polyclonal antibody

ZNF75D polyclonal antibody