DDX10 polyclonal antibody
  • DDX10 polyclonal antibody

DDX10 polyclonal antibody

Ref: AB-PAB20272
DDX10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX10.
Información adicional
Size 100 uL
Gene Name DDX10
Gene Alias HRH-J8
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSLTNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQDNDTGNEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1662
Iso type IgG

Enviar un mensaje


DDX10 polyclonal antibody

DDX10 polyclonal antibody