HDLBP polyclonal antibody
  • HDLBP polyclonal antibody

HDLBP polyclonal antibody

Ref: AB-PAB20269
HDLBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HDLBP.
Información adicional
Size 100 uL
Gene Name HDLBP
Gene Alias FLJ16432|HBP|PRO2900|VGL
Gene Description high density lipoprotein binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HDLBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3069
Iso type IgG

Enviar un mensaje


HDLBP polyclonal antibody

HDLBP polyclonal antibody