SMARCD1 polyclonal antibody
  • SMARCD1 polyclonal antibody

SMARCD1 polyclonal antibody

Ref: AB-PAB20261
SMARCD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMARCD1.
Información adicional
Size 100 uL
Gene Name SMARCD1
Gene Alias BAF60A|CRACD1|Rsc6p
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMARCD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6602
Iso type IgG

Enviar un mensaje


SMARCD1 polyclonal antibody

SMARCD1 polyclonal antibody