PDZD11 polyclonal antibody
  • PDZD11 polyclonal antibody

PDZD11 polyclonal antibody

Ref: AB-PAB20251
PDZD11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PDZD11.
Información adicional
Size 100 uL
Gene Name PDZD11
Gene Alias AIPP1|PDZK11|PISP
Gene Description PDZ domain containing 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PDZD11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51248
Iso type IgG

Enviar un mensaje


PDZD11 polyclonal antibody

PDZD11 polyclonal antibody