ITIH4 polyclonal antibody
  • ITIH4 polyclonal antibody

ITIH4 polyclonal antibody

Ref: AB-PAB20250
ITIH4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ITIH4.
Información adicional
Size 100 uL
Gene Name ITIH4
Gene Alias DKFZp686G21125|H4P|IHRP|ITIHL1|PK120
Gene Description inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ITIH4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3700
Iso type IgG

Enviar un mensaje


ITIH4 polyclonal antibody

ITIH4 polyclonal antibody