LMAN2 polyclonal antibody
  • LMAN2 polyclonal antibody

LMAN2 polyclonal antibody

Ref: AB-PAB20249
LMAN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LMAN2.
Información adicional
Size 100 uL
Gene Name LMAN2
Gene Alias C5orf8|GP36B|VIP36
Gene Description lectin, mannose-binding 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LMAN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10960
Iso type IgG

Enviar un mensaje


LMAN2 polyclonal antibody

LMAN2 polyclonal antibody