F13B polyclonal antibody
  • F13B polyclonal antibody

F13B polyclonal antibody

Ref: AB-PAB20243
F13B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant F13B.
Información adicional
Size 100 uL
Gene Name F13B
Gene Alias FXIIIB
Gene Description coagulation factor XIII, B polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human F13B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2165
Iso type IgG

Enviar un mensaje


F13B polyclonal antibody

F13B polyclonal antibody