RGAG4 polyclonal antibody
  • RGAG4 polyclonal antibody

RGAG4 polyclonal antibody

Ref: AB-PAB20236
RGAG4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RGAG4.
Información adicional
Size 100 uL
Gene Name RGAG4
Gene Alias 6430402L03Rik|KIAA2001|Mar5|Mart5
Gene Description retrotransposon gag domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq ISVTQEGSPLHANFPRFLDEIRKEFCGPIPPRVAKKAIRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSEFFRKELLWSTEMADLDELILECVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RGAG4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340526
Iso type IgG

Enviar un mensaje


RGAG4 polyclonal antibody

RGAG4 polyclonal antibody