MAD1L1 polyclonal antibody
  • MAD1L1 polyclonal antibody

MAD1L1 polyclonal antibody

Ref: AB-PAB20232
MAD1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAD1L1.
Información adicional
Size 100 uL
Gene Name MAD1L1
Gene Alias HsMAD1|MAD1|PIG9|TP53I9|TXBP181
Gene Description MAD1 mitotic arrest deficient-like 1 (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLEIRRAPPLSNN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAD1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8379
Iso type IgG

Enviar un mensaje


MAD1L1 polyclonal antibody

MAD1L1 polyclonal antibody