SERPINA4 polyclonal antibody
  • SERPINA4 polyclonal antibody

SERPINA4 polyclonal antibody

Ref: AB-PAB20229
SERPINA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SERPINA4.
Información adicional
Size 100 uL
Gene Name SERPINA4
Gene Alias KAL|KLST|KST|PI4|kallistatin
Gene Description serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SERPINA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5267
Iso type IgG

Enviar un mensaje


SERPINA4 polyclonal antibody

SERPINA4 polyclonal antibody