FCGBP polyclonal antibody
  • FCGBP polyclonal antibody

FCGBP polyclonal antibody

Ref: AB-PAB20220
FCGBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FCGBP.
Información adicional
Size 100 uL
Gene Name FCGBP
Gene Alias FC(GAMMA)BP
Gene Description Fc fragment of IgG binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FCGBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8857
Iso type IgG

Enviar un mensaje


FCGBP polyclonal antibody

FCGBP polyclonal antibody