FOXN2 polyclonal antibody
  • FOXN2 polyclonal antibody

FOXN2 polyclonal antibody

Ref: AB-PAB20217
FOXN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FOXN2.
Información adicional
Size 100 uL
Gene Name FOXN2
Gene Alias HTLF
Gene Description forkhead box N2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FOXN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3344
Iso type IgG

Enviar un mensaje


FOXN2 polyclonal antibody

FOXN2 polyclonal antibody