ZNF540 polyclonal antibody
  • ZNF540 polyclonal antibody

ZNF540 polyclonal antibody

Ref: AB-PAB20213
ZNF540 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF540.
Información adicional
Size 100 uL
Gene Name ZNF540
Gene Alias DKFZp313K2238|DKFZp547B0714|FLJ16004|Nbla10512
Gene Description zinc finger protein 540
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSSEKDIHEISLSKESIIEKSKTLRLKGSIFRNEWQNKSEFEGQQGLKERSISQKKIVSKKMSTDRKRPSFTLNQRIHNSEKSCDSHLVQHGKIDSDVKHDCKECGSTFNNVYQLTLHQKIHTGEKSCKCEKCGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF540.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163255
Iso type IgG

Enviar un mensaje


ZNF540 polyclonal antibody

ZNF540 polyclonal antibody