CHCHD10 polyclonal antibody
  • CHCHD10 polyclonal antibody

CHCHD10 polyclonal antibody

Ref: AB-PAB20212
CHCHD10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHCHD10.
Información adicional
Size 100 uL
Gene Name CHCHD10
Gene Alias C22orf16|MGC70831|N27C7-4
Gene Description coiled-coil-helix-coiled-coil-helix domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHCHD10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 400916
Iso type IgG

Enviar un mensaje


CHCHD10 polyclonal antibody

CHCHD10 polyclonal antibody