IFT43 polyclonal antibody
  • IFT43 polyclonal antibody

IFT43 polyclonal antibody

Ref: AB-PAB20211
IFT43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFT43.
Información adicional
Size 100 uL
Gene Name IFT43
Gene Alias C14orf179|CED3
Gene Description intraflagellar transport 43 homolog (Chlamydomonas)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IFT43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 112752
Iso type IgG

Enviar un mensaje


IFT43 polyclonal antibody

IFT43 polyclonal antibody