IVNS1ABP polyclonal antibody
  • IVNS1ABP polyclonal antibody

IVNS1ABP polyclonal antibody

Ref: AB-PAB20208
IVNS1ABP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IVNS1ABP.
Información adicional
Size 100 uL
Gene Name IVNS1ABP
Gene Alias DKFZp686K06216|FLARA3|FLJ10069|FLJ10411|FLJ10962|FLJ35593|FLJ36593|HSPC068|KIAA0850|ND1|NS-1|NS1-BP|NS1BP
Gene Description influenza virus NS1A binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IVNS1ABP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10625
Iso type IgG

Enviar un mensaje


IVNS1ABP polyclonal antibody

IVNS1ABP polyclonal antibody