RPS24 polyclonal antibody
  • RPS24 polyclonal antibody

RPS24 polyclonal antibody

Ref: AB-PAB20199
RPS24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPS24.
Información adicional
Size 100 uL
Gene Name RPS24
Gene Alias DBA3|DKFZp686N1586
Gene Description ribosomal protein S24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPS24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6229
Iso type IgG

Enviar un mensaje


RPS24 polyclonal antibody

RPS24 polyclonal antibody