ZNF146 polyclonal antibody
  • ZNF146 polyclonal antibody

ZNF146 polyclonal antibody

Ref: AB-PAB20198
ZNF146 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF146.
Información adicional
Size 100 uL
Gene Name ZNF146
Gene Alias MGC125660|MGC125661|OZF
Gene Description zinc finger protein 146
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq LSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF146.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7705
Iso type IgG

Enviar un mensaje


ZNF146 polyclonal antibody

ZNF146 polyclonal antibody