CNTN3 polyclonal antibody
  • CNTN3 polyclonal antibody

CNTN3 polyclonal antibody

Ref: AB-PAB20194
CNTN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNTN3.
Información adicional
Size 100 uL
Gene Name CNTN3
Gene Alias BIG-1|KIAA1496|PANG|PCS
Gene Description contactin 3 (plasmacytoma associated)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQVQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGTYTCMAENQFGKANGTTHLVVTEPTRI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNTN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5067
Iso type IgG

Enviar un mensaje


CNTN3 polyclonal antibody

CNTN3 polyclonal antibody