ZNF780B polyclonal antibody
  • ZNF780B polyclonal antibody

ZNF780B polyclonal antibody

Ref: AB-PAB20190
ZNF780B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF780B.
Información adicional
Size 100 uL
Gene Name ZNF780B
Gene Alias ZNF779
Gene Description zinc finger protein 780B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SHLISLGSSISKPDVITLLEQEKEPWIVVSKETSRWYPDLESKYGPEKISPENDIFEINLPKHVIKQISKTLGLEAFYFRNDSEYRSRFEGRQGHQEGYINQKIISYEEMPA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF780B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163131
Iso type IgG

Enviar un mensaje


ZNF780B polyclonal antibody

ZNF780B polyclonal antibody