RBM44 polyclonal antibody
  • RBM44 polyclonal antibody

RBM44 polyclonal antibody

Ref: AB-PAB20189
RBM44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM44.
Información adicional
Size 100 uL
Gene Name RBM44
Gene Alias FLJ40411
Gene Description RNA binding motif protein 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YRESAEDTQKHDTDEDSQQEYHSAEEQEYISNHLSFDQTKALDISNPEVVELGNSGYEVKCASNVEDNRVNSGSGSIISFDSLDVYGQEESLHVSKFQNSVMLREYHDLKHEKYKEQETNSMYHTVFDGSVLRSNSPGNQESQSKSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375316
Iso type IgG

Enviar un mensaje


RBM44 polyclonal antibody

RBM44 polyclonal antibody