CD2AP polyclonal antibody Ver mas grande

CD2AP polyclonal antibody

AB-PAB20186

Producto nuevo

CD2AP polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name CD2AP
Gene Alias CMS|DKFZp586H0519
Gene Description CD2-associated protein
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq WSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD2AP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23607
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant CD2AP.

Consulta sobre un producto

CD2AP polyclonal antibody

CD2AP polyclonal antibody