CD2AP polyclonal antibody
  • CD2AP polyclonal antibody

CD2AP polyclonal antibody

Ref: AB-PAB20186
CD2AP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CD2AP.
Información adicional
Size 100 uL
Gene Name CD2AP
Gene Alias CMS|DKFZp586H0519
Gene Description CD2-associated protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq WSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD2AP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23607
Iso type IgG

Enviar un mensaje


CD2AP polyclonal antibody

CD2AP polyclonal antibody