LRCH2 polyclonal antibody
  • LRCH2 polyclonal antibody

LRCH2 polyclonal antibody

Ref: AB-PAB20185
LRCH2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRCH2.
Información adicional
Size 100 uL
Gene Name LRCH2
Gene Alias KIAA1495|MGC150671|dA204F4.4
Gene Description leucine-rich repeats and calponin homology (CH) domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GIGSDNGEKRLSTTEPSDDDTVSLHSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQGNAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKNRI
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRCH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57631
Iso type IgG

Enviar un mensaje


LRCH2 polyclonal antibody

LRCH2 polyclonal antibody