ZNF90 polyclonal antibody
  • ZNF90 polyclonal antibody

ZNF90 polyclonal antibody

Ref: AB-PAB20182
ZNF90 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF90.
Información adicional
Size 100 uL
Gene Name ZNF90
Gene Alias HTF9
Gene Description zinc finger protein 90
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VVTKPDLITCLEQGKKPFTVKRHEMIAKSPVMCFHFAQDLCPEQSLKDSFQKVIVTRYEKREYGNLELKKGCESVDEGKVHKRGYNGLNQCLTATQSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF90.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7643
Iso type IgG

Enviar un mensaje


ZNF90 polyclonal antibody

ZNF90 polyclonal antibody