SCUBE1 polyclonal antibody
  • SCUBE1 polyclonal antibody

SCUBE1 polyclonal antibody

Ref: AB-PAB20175
SCUBE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCUBE1.
Información adicional
Size 100 uL
Gene Name SCUBE1
Gene Alias -
Gene Description signal peptide, CUB domain, EGF-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVSHITAEFEIETKMEEASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKALEGQGACGAGQVLQDSKCVACGPGTHFGGELGQCVPCMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSECGGKC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCUBE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80274
Iso type IgG

Enviar un mensaje


SCUBE1 polyclonal antibody

SCUBE1 polyclonal antibody