APOO polyclonal antibody
  • APOO polyclonal antibody

APOO polyclonal antibody

Ref: AB-PAB20174
APOO polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APOO.
Información adicional
Size 100 uL
Gene Name APOO
Gene Alias FAM121B|MGC4825|MYO25|My025
Gene Description apolipoprotein O
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APOO.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79135
Iso type IgG

Enviar un mensaje


APOO polyclonal antibody

APOO polyclonal antibody