ZNF177 polyclonal antibody
  • ZNF177 polyclonal antibody

ZNF177 polyclonal antibody

Ref: AB-PAB20169
ZNF177 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF177.
Información adicional
Size 100 uL
Gene Name ZNF177
Gene Alias PIGX
Gene Description zinc finger protein 177
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTNCVRTHSGEMP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF177.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7730
Iso type IgG

Enviar un mensaje


ZNF177 polyclonal antibody

ZNF177 polyclonal antibody