COX8C polyclonal antibody
  • COX8C polyclonal antibody

COX8C polyclonal antibody

Ref: AB-PAB20166
COX8C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COX8C.
Información adicional
Size 100 uL
Gene Name COX8C
Gene Alias COX8-3|MGC119774|MGC119775
Gene Description cytochrome c oxidase subunit 8C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COX8C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 341947
Iso type IgG

Enviar un mensaje


COX8C polyclonal antibody

COX8C polyclonal antibody