BAIAP2L2 polyclonal antibody
  • BAIAP2L2 polyclonal antibody

BAIAP2L2 polyclonal antibody

Ref: AB-PAB20156
BAIAP2L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BAIAP2L2.
Información adicional
Size 100 uL
Gene Name BAIAP2L2
Gene Alias FLJ22582
Gene Description BAI1-associated protein 2-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BAIAP2L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80115
Iso type IgG

Enviar un mensaje


BAIAP2L2 polyclonal antibody

BAIAP2L2 polyclonal antibody