LHFPL1 polyclonal antibody
  • LHFPL1 polyclonal antibody

LHFPL1 polyclonal antibody

Ref: AB-PAB20154
LHFPL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LHFPL1.
Información adicional
Size 100 uL
Gene Name LHFPL1
Gene Alias MGC118798|MGC118800|MGC118801
Gene Description lipoma HMGIC fusion partner-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GKPVSFSTFRRCNYPVRGEGHSLIMVEECGRYASFNAIPSLAWQMCT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LHFPL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340596
Iso type IgG

Enviar un mensaje


LHFPL1 polyclonal antibody

LHFPL1 polyclonal antibody