RBM25 polyclonal antibody
  • RBM25 polyclonal antibody

RBM25 polyclonal antibody

Ref: AB-PAB20152
RBM25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM25.
Información adicional
Size 100 uL
Gene Name RBM25
Gene Alias MGC105088|MGC117168|RED120|RNPC7|S164|fSAP94
Gene Description RNA binding motif protein 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 58517
Iso type IgG

Enviar un mensaje


RBM25 polyclonal antibody

RBM25 polyclonal antibody