GPM6B polyclonal antibody
  • GPM6B polyclonal antibody

GPM6B polyclonal antibody

Ref: AB-PAB20138
GPM6B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPM6B.
Información adicional
Size 100 uL
Gene Name GPM6B
Gene Alias M6B|MGC17150|MGC54284
Gene Description glycoprotein M6B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPM6B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2824
Iso type IgG

Enviar un mensaje


GPM6B polyclonal antibody

GPM6B polyclonal antibody