DNAAF2 polyclonal antibody
  • DNAAF2 polyclonal antibody

DNAAF2 polyclonal antibody

Ref: AB-PAB20137
DNAAF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAAF2.
Información adicional
Size 100 uL
Gene Name DNAAF2
Gene Alias C14orf104|CILD10|KTU|PF13
Gene Description dynein, axonemal, assembly factor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKGNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAAF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55172
Iso type IgG

Enviar un mensaje


DNAAF2 polyclonal antibody

DNAAF2 polyclonal antibody