ATP5D polyclonal antibody
  • ATP5D polyclonal antibody

ATP5D polyclonal antibody

Ref: AB-PAB20134
ATP5D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATP5D.
Información adicional
Size 100 uL
Gene Name ATP5D
Gene Alias -
Gene Description ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq PNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATP5D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 513
Iso type IgG

Enviar un mensaje


ATP5D polyclonal antibody

ATP5D polyclonal antibody